Protein Info for HSERO_RS04240 in Herbaspirillum seropedicae SmR1

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03480: DctP" amino acids 30 to 314 (285 residues), 371.7 bits, see alignment E=1.2e-115 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 30 to 285 (256 residues), 335.8 bits, see alignment E=8.2e-105

Best Hits

Swiss-Prot: 68% identical to DCTP_RHOCA: C4-dicarboxylate-binding periplasmic protein DctP (dctP) from Rhodobacter capsulatus

KEGG orthology group: K11688, C4-dicarboxylate-binding protein DctP (inferred from 100% identity to hse:Hsero_0844)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J025 at UniProt or InterPro

Protein Sequence (334 amino acids)

>HSERO_RS04240 C4-dicarboxylate ABC transporter (Herbaspirillum seropedicae SmR1)
MKLKSILLAMTAAAIVSTNAFAQQPIVIKFSHVVANDTPKGKAAERFKELAEKATKGRVK
IEVYPNSTLYKDKEELEALQLGAVQMLAPSLAKFGPLGVKEFEVFDLPYIFPTKEVLYRV
TEGPIGKDLFKKLEPKGITGLAYWDNGFKVMSANKPLHHPADFRGLKMRIQSSKVLDAQM
RALGANPQVLAFSEVYQALQTGVVDGTENPPSNLYTQKMHEVQKHVTVSNHGYLGYAVIV
NKKFWDGLPSDIRTQLEGAMKDATKYANAIAQQENDAALAAVEKTGKTTVYRLTDAEKAE
WRKALLPVQQQMASRIGKDLIDAVNKESAALGQK