Protein Info for HSERO_RS04225 in Herbaspirillum seropedicae SmR1

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 52 (17 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 100 to 116 (17 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 150 to 292 (143 residues), 42.5 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to hse:Hsero_0841)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J022 at UniProt or InterPro

Protein Sequence (296 amino acids)

>HSERO_RS04225 permease (Herbaspirillum seropedicae SmR1)
LEILNLLLPDFSLIALGVLVYRISNWGDEFWAGMEKLVYFLLFPALLFYSTARLKVDLSV
TGGLVQTGLLALLAGIALTWLGKPFLRSTPMTYESGMQCAYRFNSYIALALATRMAGEEG
AGLMAILLGFGVPLCNIAAVHALAPKNSNLLRELAKNPLLVATAGGLTFSALGLHLPEVA
GVVLSRLGAASIALGLLMVGAGLRLSGLKESKPVVGWFVFIKLFAVPAVAWLIGQHLQLP
PLQLRIVVLFCSLPTASSAYILAARMGGNGPFTAFLISFGTLLSALTIPFWLALVH