Protein Info for HSERO_RS04220 in Herbaspirillum seropedicae SmR1

Annotation: epoxyqueuosine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR00276: epoxyqueuosine reductase" amino acids 28 to 378 (351 residues), 467.8 bits, see alignment E=9.1e-145 PF08331: QueG_DUF1730" amino acids 76 to 163 (88 residues), 75.1 bits, see alignment E=3.4e-25 PF13484: Fer4_16" amino acids 215 to 279 (65 residues), 82.5 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 68% identical to QUEG_BURPS: Epoxyqueuosine reductase (queG) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0840)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J021 at UniProt or InterPro

Protein Sequence (381 amino acids)

>HSERO_RS04220 epoxyqueuosine reductase (Herbaspirillum seropedicae SmR1)
MTANAVPAAATANDLADPAYLAALAAAIKDWGRELGFADVRIADVDLSHREAGFQAWLDK
GYHGEMDYMASHGLKRARPAELVPGTVRVVSVRMPYLPKASGPAEPDWRAREEARSADPG
GAQVSIYARGRDYHKVLRARLQQLATRIEGRIGPFGYRVFTDSAPVMEVALAEKAGLGWR
GKHTLLLHREAGSMFFLGEMLTDLPLPVDDPVTPHCGQCSACITACPTGAIVAPYELDAR
RCISYLTIELKGSIPSELRPLIGNRIYGCDDCQLYCPWNKFAQRASLPDFDVRHGLDSAS
LVGLFGWSEEEFLKNTEGSAIRRIGHERWLRNLAVGLGNAADAASHRGDAAIVAALRARL
AHPSALVVEHVQWALARHGVS