Protein Info for HSERO_RS04065 in Herbaspirillum seropedicae SmR1

Annotation: pilus biosynthesis protein PilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details PF05307: Bundlin" amino acids 56 to 174 (119 residues), 33.2 bits, see alignment E=6e-12 PF08805: PilS" amino acids 58 to 183 (126 residues), 77.7 bits, see alignment E=9.1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0812)

Predicted SEED Role

"Putative type IV pilin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZZ4 at UniProt or InterPro

Protein Sequence (183 amino acids)

>HSERO_RS04065 pilus biosynthesis protein PilS (Herbaspirillum seropedicae SmR1)
MQDEKVKDSHRPAIRSDSPLQRQQGASLLEGIAYLGIAAIVVMGAISLLTGAFSSAKSNQ
ANEEVIGLRTAVRKLYMGQTYPTTAVVDTLIAAKAVPGTLAIDGGALKNSWGGTVAVAGS
GTGFTITYPQVPKDVCVSMLSGANGWTSVNANGGTAVQTFPVTASQATGLCTAADNSVVY
TSS