Protein Info for HSERO_RS03645 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): D-mannose ABC transporter, permease component
Rationale: Specific phenotype on D-mannose
Original annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 93 to 128 (36 residues), see Phobius details amino acids 131 to 158 (28 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 268 to 297 (30 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 325 (265 residues), 135.8 bits, see alignment E=7.9e-44

Best Hits

Swiss-Prot: 47% identical to RBSC_HAEIN: Ribose import permease protein RbsC (rbsC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to hse:Hsero_0729)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZC8 at UniProt or InterPro

Protein Sequence (339 amino acids)

>HSERO_RS03645 D-mannose ABC transporter, permease component (Herbaspirillum seropedicae SmR1)
MTHTHDAVPPGARRSSSTTAQWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAEN
TMNILRQVAINLVLAAGMTFVILTAGIDLSVGSVLAVSAVLGMQVSLGAAPGWAIPMFIF
SGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNGDF
LHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSISGL
FSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIGVMN
NGLTILGLSSFWQYVAKGAVIVLAVILDKWRQKDAAQSA