Protein Info for HSERO_RS03630 in Herbaspirillum seropedicae SmR1

Annotation: fructose transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00485: PRK
  • amino acids 21 to 202 (182 residues), 27.8 bits, E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0726)

Predicted SEED Role

"Pantothenate kinase (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• phosphopantothenate biosynthesis II (1/3 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.33

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

See D8IZC5 at UniProt or InterPro

Protein Sequence (205 amino acids)

>HSERO_RS03630 fructose transporter (Herbaspirillum seropedicae SmR1)
MMSAVYRDRVQALLASGQRKILGIAGAPGSGKSTLAQALLEQAGERAVVLPMDGYHLANA
ELARLGRAARKGAEDTFDSAGYVALLSRLRSQGGDELIYAPQFLREIEEAVAGAIPIPPS
TQLIITEGNYLLLDRGHWARVRPLLDECWYLEVDPTLRVQRLIARHVQFGRTPEAARAWV
MDSDEANAALIETTRPRADLIFRWD