Protein Info for HSERO_RS03300 in Herbaspirillum seropedicae SmR1

Annotation: molybdenum cofactor biosynthesis protein MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 13 to 161 (149 residues), 193.3 bits, E=9.5e-62
• PF01967: MoaC
  • amino acids 24 to 159 (136 residues), 187.2 bits, E=6.8e-60

Best Hits

Swiss-Prot: 74% identical to MOAC_BURVG: Cyclic pyranopterin monophosphate synthase (moaC) from Burkholderia vietnamiensis (strain G4 / LMG 22486)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to hse:Hsero_0661)

MetaCyc: 52% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See D8IYM0 at UniProt or InterPro

Protein Sequence (168 amino acids)

>HSERO_RS03300 molybdenum cofactor biosynthesis protein MoaC (Herbaspirillum seropedicae SmR1)
MTTPGAPAANGGLTHFDQGGQAHMVDVGGKHESHRVAVATGVIRMQPATLAIIESGTAKK
GDVLGIARIAAIMAAKRTGDLIPLCHPLALTHVSVDFETDAASASVRCTARVETFGKTGV
EMEALTAVQIGLLTVYDMSKAVDKTMVMSDICVTDKRGGKSDISMPRP