Protein Info for HSERO_RS03275 in Herbaspirillum seropedicae SmR1

Annotation: regulatory protein RecX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF02631: RecX" amino acids 36 to 145 (110 residues), 85 bits, see alignment E=2.9e-28

Best Hits

Swiss-Prot: 100% identical to RECX_HERSE: Regulatory protein RecX (recX) from Herbaspirillum seropedicae

KEGG orthology group: K03565, regulatory protein (inferred from 100% identity to hse:Hsero_0656)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYL5 at UniProt or InterPro

Protein Sequence (154 amino acids)

>HSERO_RS03275 regulatory protein RecX (Herbaspirillum seropedicae SmR1)
MPRPPISLKARALKYLSSREHSRLELARKLAPYAQEGDDIEALLQWLEQSRFLSQERFSE
SLVHRRAARYGNQRILSELHGHGIEGEAIADLKADLAAGEAERAAQVLRRKFTAPPADAE
TRAKQMRFLQQRGFSHRSIREAFQTAWLDEDDPS