Protein Info for HSERO_RS03270 in Herbaspirillum seropedicae SmR1

Annotation: protein RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR02012: protein RecA" amino acids 11 to 331 (321 residues), 567.2 bits, see alignment E=5.4e-175 PF00154: RecA" amino acids 14 to 275 (262 residues), 474 bits, see alignment E=2.6e-146 PF08423: Rad51" amino acids 43 to 235 (193 residues), 33.1 bits, see alignment E=7.1e-12 PF06745: ATPase" amino acids 47 to 211 (165 residues), 32.2 bits, see alignment E=1.5e-11 PF21096: RecA_C" amino acids 279 to 334 (56 residues), 97.6 bits, see alignment E=7e-32

Best Hits

Swiss-Prot: 100% identical to RECA_HERSE: Protein RecA (recA) from Herbaspirillum seropedicae

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to hse:Hsero_0655)

MetaCyc: 71% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYL4 at UniProt or InterPro

Protein Sequence (351 amino acids)

>HSERO_RS03270 protein RecA (Herbaspirillum seropedicae SmR1)
MDDKKAANNSEKSKALAAALAQIEKQFGKGSVMRMEDGVIAEEIQAVSTGSLGLDIALGI
GGLPRGRVIEIYGPESSGKTTLTLQSIAEMQKLGGTCAFIDAEHALDVTYAQKLGVNLND
LLISQPDTGEQALEICDALVRSGAVDLIVVDSVAALTPKAEIEGDMGDSLPGLQARLMSQ
ALRKLTGSINRTNTTVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGSIKS
GDEVIGSETKVKVVKNKVAPPFREAHFDILYGEGTSREGEILDLGSEHKVVEKSGAWYSY
NGERIGQGKDNARNYLKEHPELAREIENKVRVALGVPELAGGEAEAEAKAS