Protein Info for HSERO_RS02805 in Herbaspirillum seropedicae SmR1

Annotation: 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00549, 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC: 2.1.1.14] (inferred from 100% identity to hse:Hsero_0560)

Predicted SEED Role

"5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14)" in subsystem Methionine Biosynthesis (EC 2.1.1.14)

MetaCyc Pathways

aspartate superpathway (23/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
L-methionine biosynthesis III (4/4 steps found)
S-adenosyl-L-methionine salvage II (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
S-adenosyl-L-methionine salvage I (3/4 steps found)
L-methionine biosynthesis I (3/5 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYB9 at UniProt or InterPro

Protein Sequence (342 amino acids)

>HSERO_RS02805 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase (Herbaspirillum seropedicae SmR1)
VKKRLPTSTAGSLPKPAWLAEPEKLWSPWKLQGAELEDAKRDALRLSLQEQQHAGIDIVS
DGEQTRQHFVTTFIEHLDGVDFAKRETVRIRNRYDASVPTVVGAVSRPKPVFVDDARFLR
SQTDQPIKWALPGPMTMIDTLYDSHYKSREKLAWEFATLLNQEARELEAAGVDIIQFDEP
AFNVFFDEVNDWGVATLERAIEGLKCETAVHICYGYGIKANTDWKKTLGSEWRQYEETFP
RLQASSIDIVSLECHNARVPMDLIELIRGKKVMVGAIDVANHGVESAEEVAATLRRALQF
VEADKLYPCTNCGMAPLPRDVARGKLAALSAGAEIVRRELGA