Protein Info for HSERO_RS02600 in Herbaspirillum seropedicae SmR1

Annotation: bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details PF13593: SBF_like" amino acids 7 to 314 (308 residues), 319 bits, see alignment E=3.5e-99 PF01758: SBF" amino acids 40 to 214 (175 residues), 62.8 bits, see alignment E=3.7e-21

Best Hits

Swiss-Prot: 55% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0523)

Predicted SEED Role

"Sodium - Bile acid symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXG7 at UniProt or InterPro

Protein Sequence (337 amino acids)

>HSERO_RS02600 bile acid:sodium symporter (Herbaspirillum seropedicae SmR1)
MNRFLPDRFTQLLIGTVLLATLFPATGSFEQFMHVASNVAISLLFFLHGAKLSREAALAG
LKQPRLHLLTLGSTFLLFPLLGLGLKAVAPDLLTPQLWMGVLFVCTLSSTVQSSIGFTSI
ARGNVPAAICGATASNLLGILVTPLLVTLLLHRHHEANGLSQVLSILLQLLLPFVLGNLL
RPWIGDWINRHKVIVNVVDRGGILLSVYAAFSAAVAQGIWHLFPPGQLALLVLVNAMLLG
AVLLITTYGARALKMPRGDEIVLVFCGSKKSLASGIPIASVLFAGSGAAVVLLPIMLFHQ
MQLMLCAVLARRYAAQQDHLDADDASSQRAATLAGSR