Protein Info for HSERO_RS02555 in Herbaspirillum seropedicae SmR1

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 169 to 192 (24 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details PF00989: PAS" amino acids 11 to 111 (101 residues), 45.3 bits, see alignment E=2.1e-15 TIGR00229: PAS domain S-box protein" amino acids 17 to 114 (98 residues), 56.7 bits, see alignment E=1.3e-19 PF13426: PAS_9" amino acids 20 to 110 (91 residues), 43.7 bits, see alignment E=7.1e-15 PF08448: PAS_4" amino acids 25 to 112 (88 residues), 25.1 bits, see alignment E=4.2e-09 PF08447: PAS_3" amino acids 30 to 114 (85 residues), 56.7 bits, see alignment E=5.8e-19 PF00015: MCPsignal" amino acids 334 to 488 (155 residues), 163.2 bits, see alignment E=1.4e-51

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 100% identity to hse:Hsero_0514)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXF8 at UniProt or InterPro

Protein Sequence (523 amino acids)

>HSERO_RS02555 chemotaxis protein (Herbaspirillum seropedicae SmR1)
MRKNLPITTTERLLEDGKSIVSKTDLQGNILYVNPYFIEISGFEEEELIGAPQNIVRHPE
MPREAFADMWATLKEGLPWNGLVKNRCKNGDYYWVQANVTPVRENGRAVGYMSVRTRPSR
EQVQAAEAAYRKFSAGQARGLRVHRGAVVRTGLTGWLQGLRELPVARRLGWTMGVLTLMF
ILGGAVAGNAVMSAGGSPFAVWLGTAAGALMLLASWAMLHASIVAPLQRAIKAVHGLAGG
DLDSHIDTTARGDMGLLLQALQQLNVNLRAIIGDVRRNVESMTISTGEIANGNMDLSGRT
EAQASALEETASSVEEFAATVRQNADSAANADRQAQSASAIAQRGGSSVQRMGRTMEEID
AASHKIVDIIGLIDGISFQTNILALNAAVEAARAGEQGRGFAVVAAEVRTLAQRSAAAAK
DIKGLIDDSRAKVESGNQLVRETAQAMGELGGAVENMAVTMAEITVASNEQSGGIEQLNQ
AVNAIDETTQQNAALVEQAAAAAENLRDQAVKLSQAVSVFKIS