Protein Info for HSERO_RS02305 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 182 to 207 (26 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 257 (178 residues), 93.2 bits, see alignment E=8.7e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to hse:Hsero_0462)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXB2 at UniProt or InterPro

Protein Sequence (267 amino acids)

>HSERO_RS02305 ABC transporter ATP-binding protein (Herbaspirillum seropedicae SmR1)
MKPNTDPLVNRPGFWRVAAPLIIGIALLLMWQIVCTLLEVPPYLVPTPALIVKTLAADWS
MLMASLLVTLKITFLAFALAVVLGVAIAFVFVQSRFIEISLFPYAIILQVTPIVAIAPLI
IIWVKDTTAALTVCATIMALFPIISNTTLGLRSVNPGLLNLFRLNKATRWQTLRRLRIPS
ALPYFFGGLRISSGLALIGAVVAEFVAGTGGTGSGLAYQILQAGFQLNIPRLFAALLLIT
LTGILLFWLMSALSRAMLAGWHESEMA