Protein Info for HSERO_RS02200 in Herbaspirillum seropedicae SmR1

Annotation: mannitol ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 258 (174 residues), 52.7 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K10229, sorbitol/mannitol transport system permease protein (inferred from 100% identity to hse:Hsero_0442)

MetaCyc: 64% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX92 at UniProt or InterPro

Protein Sequence (271 amino acids)

>HSERO_RS02200 mannitol ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSDPKKSPLWVAVLGWACAIVLFFPIFWVAVTAFKTESQAYTPSLVFLPTLETFREVFSR
SHYLGYVQNSLIVSLGSTLLSLLLAVPAAYSMAFFPTGRTQKLLLWMLSTKMMPAVGVLI
PIYLMAKNTGLLDTVTGLTIIYTLINLPIAVWMAFTYFNDVPKEILEAARIDGANAWQEM
IYLLLPTAMPGLASTALLLVILSWNEAFWSLNLTSVNAAPLTVFIASYSNPEGLFWAKLS
AASLLAIAPIMALGWLAQKQLVRGLTFGAVK