Protein Info for HSERO_RS02150 in Herbaspirillum seropedicae SmR1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 211 to 236 (26 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 254 (241 residues), 58.2 bits, see alignment E=3.6e-20 amino acids 218 to 381 (164 residues), 53.8 bits, see alignment E=7.5e-19

Best Hits

Swiss-Prot: 61% identical to Y3201_BURP0: Uncharacterized MFS-type transporter BURPS1106A_3201 (BURPS1106A_3201) from Burkholderia pseudomallei (strain 1106a)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0432)

Predicted SEED Role

"Xanthine transporter,putative" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX82 at UniProt or InterPro

Protein Sequence (391 amino acids)

>HSERO_RS02150 MFS transporter (Herbaspirillum seropedicae SmR1)
LTPAKVTRQIIATAFFTFLVYLAIGIPMAVLPGYIHLDLGYSSVMAGLGISVQYFATFVS
RANAGRMIDTVGAKQTVMRGMLLCSASGALLLCSALAQPLPFLSLVLLFASRALLGLGES
LVGTGAIMWGVGRVGSENTAKMISWNGIATYAALAIGAPLGVVLDRSLGFAMIGLSGMLL
TALGYVLARGGPVTPVVQGEQLSFKLVLRKVFAYGMGLAFGTIGFGSIATFITLYYADLH
WSGAAFALTAFSSAFVGARLLFANAITRFGGYRVAVVSFLTEAVGLLLLWSTTTPELALL
GAGLAGFGFALVFPSLGVEAVNLVSPANRGAALAAYSVFLDLALGITGPLAGAIAGQLGY
PQVFLFAAIAAIGAVALSLSLYRSAQQRGKP