Protein Info for HSERO_RS02090 in Herbaspirillum seropedicae SmR1
Annotation: Holliday junction DNA helicase RuvA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 84% identical to RUVA_HERAR: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Herminiimonas arsenicoxydans
KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 100% identity to hse:Hsero_0421)Predicted SEED Role
"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8IX71 at UniProt or InterPro
Protein Sequence (192 amino acids)
>HSERO_RS02090 Holliday junction DNA helicase RuvA (Herbaspirillum seropedicae SmR1) MIGRLSGILLEKLPPNLLVDCQGVGYEVAVPMSTYYNLPALGEKVTLLTHLAIREDAHIL FGFGTAEERNTFKELIKISGVGARTALSILSGMSVADLAQAVTLQEAGRLTRVPGIGKKT AERLLLELKGKLGADLGAVAGVVHSDASADILNALLALGYSDKEATLAMKQVPKDSTVSD GIKLALKALSKG