Protein Info for HSERO_RS02000 in Herbaspirillum seropedicae SmR1

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 262 to 282 (21 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 3 to 320 (318 residues), 241.2 bits, see alignment E=9e-76 PF01544: CorA" amino acids 28 to 316 (289 residues), 185.3 bits, see alignment E=8.5e-59

Best Hits

Swiss-Prot: 50% identical to CORA_YERPS: Magnesium transport protein CorA (corA) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to hse:Hsero_0403)

MetaCyc: 49% identical to Ni2+/Co2+/Mg2+ transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-141; TRANS-RXN-141A; TRANS-RXN-141B

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX53 at UniProt or InterPro

Protein Sequence (321 amino acids)

>HSERO_RS02000 magnesium transporter (Herbaspirillum seropedicae SmR1)
MINVFVLQNGRLSQVNIDSRTDLEQAAPVWVDLTEPNDEERAWVKSIYGVTLPDEDEFSD
IEASARYFEAENGDLHLRTDFLFEGDDDSSSTMTVAFILARNILFSVHAEDLPVFRLVRM
RARSRPGSIGDYRDVLLDLYETDAEYSADALEGIYQKLEAVSTSVLKKSLSDQDAAEVLN
TIAHEEDLNGRIRRNMMDTRRAVSFLMRGRLLSSEQFEDARQILRDIESLDGHTAFLFDK
INFLMDATVGFININQNKIIKIFSVASVAFLPPTLIASIYGMNFKIMPELDWAIGYPLAI
LMMIGSAIAPFWYFRRRGWLN