Protein Info for HSERO_RS01975 in Herbaspirillum seropedicae SmR1

Annotation: 4-hydroxybenzoate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF04345: Chor_lyase" amino acids 27 to 186 (160 residues), 81.8 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 43% identical to UBIC_CUPNH: Probable chorismate pyruvate-lyase (ubiC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 100% identity to hse:Hsero_0398)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX48 at UniProt or InterPro

Protein Sequence (201 amino acids)

>HSERO_RS01975 4-hydroxybenzoate synthetase (Herbaspirillum seropedicae SmR1)
MPRGVGRARWMAHPQALAGQLAEQGGVARRTRAWLSDPGSMTLKLKARTAHFTVRLLRQR
PGPILADEHAALGVPARSRVVERDVILHCDGQPVVFGHTVLSTASVKSDWPFFSKLGNTP
LGANLFFDPLVGRSPIQYARLAADHPLMRRIVQALPGLPLPPSLLARRSLFTRRGGVLMV
TDVFLPALEPLMRSRPAHAPD