Protein Info for HSERO_RS01800 in Herbaspirillum seropedicae SmR1

Annotation: 50S ribosomal protein L21

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00829: Ribosomal_L21p
  • amino acids 1 to 101 (101 residues), 132.5 bits, E=2.8e-43
• TIGR00061: ribosomal protein bL21
  • amino acids 2 to 101 (100 residues), 121 bits, E=1.2e-39

Best Hits

Swiss-Prot: 92% identical to RL21_JANMA: 50S ribosomal protein L21 (rplU) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 100% identity to hse:Hsero_0364)

MetaCyc: 47% identical to 50S ribosomal subunit protein L21 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L21p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See D8IW91 at UniProt or InterPro

Protein Sequence (103 amino acids)

>HSERO_RS01800 50S ribosomal protein L21 (Herbaspirillum seropedicae SmR1)
MYAVIKTGGKQYKVAAGEKLKVEQIPADIGSEITLDQVLAVGAGETVKFGAPLVAGATVL
ATVVAQGRHDKVRIFKMRRRKHYQKRQGHRQNYTELQIVSINA