Protein Info for HSERO_RS01670 in Herbaspirillum seropedicae SmR1

Annotation: UDP-N-acetylmuramate--alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 7 to 458 (452 residues), 535.8 bits, see alignment E=5.1e-165 PF01225: Mur_ligase" amino acids 7 to 105 (99 residues), 99.7 bits, see alignment E=1.5e-32 PF08245: Mur_ligase_M" amino acids 110 to 290 (181 residues), 96.3 bits, see alignment E=3.7e-31 PF02875: Mur_ligase_C" amino acids 313 to 404 (92 residues), 47.7 bits, see alignment E=2.4e-16

Best Hits

Swiss-Prot: 85% identical to MURC_JANMA: UDP-N-acetylmuramate--L-alanine ligase (murC) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to hse:Hsero_0337)

MetaCyc: 53% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IW65 at UniProt or InterPro

Protein Sequence (475 amino acids)

>HSERO_RS01670 UDP-N-acetylmuramate--alanine ligase (Herbaspirillum seropedicae SmR1)
MKHRVKNIHFVGIGGSGMSGIAEVLLNLGYGVSGSDLGSNAATQRLAQLGACIRYGHAAG
NIEGADAIVTSTAVKGDNPEVLAARKKHIPIVPRAVMLGELMRLKKGIAIAGTHGKTTTT
SLVASVLAQGGLDPTFVIGGRLTSAGANAKLGTGEFIVAEADESDASFLNLTPVIEVITN
IDADHMETYNHDFARLKQAFVEFTQRLPFYGVAVLCLDDPHVREIMPMVSKPILTYGFHE
DADVRAIDAKAVDGKMEFTVIQDGYAPMQVSLNQPGMHNVQNACAAIAIARELDVDDAAT
QKALTEFNGVGRRFTRYGEVPLWDAEGKPAGHFTLVDDYGHHPVETAATIAAARGAYPGR
RLVLAFQPHRYTRTRDLFEDFVKVLSSPDVLVLAEVYSAGEAPIVAADGRSLAHALRAAG
KVEPVFVDDIGDMPETIRNVVRDGDVVMTMGAGSISAVPGRLTAQADVKNEQGAA