Protein Info for HSERO_RS01475 in Herbaspirillum seropedicae SmR1

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 8 to 200 (193 residues), 197.3 bits, see alignment E=2.9e-62 PF08659: KR" amino acids 10 to 174 (165 residues), 63.3 bits, see alignment E=4.3e-21 PF13561: adh_short_C2" amino acids 14 to 213 (200 residues), 139.4 bits, see alignment E=2.3e-44

Best Hits

Swiss-Prot: 50% identical to Y432_LISMO: Uncharacterized oxidoreductase Lmo0432 (lmo0432) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0298)

MetaCyc: 34% identical to 3-oxoacyl-[acyl-carrier-protein] reductase (Bacillus subtilis subtilis 168)
3-oxoacyl-[acyl-carrier-protein] reductase. [EC: 1.1.1.100]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IW26 at UniProt or InterPro

Protein Sequence (248 amino acids)

>HSERO_RS01475 oxidoreductase (Herbaspirillum seropedicae SmR1)
MSNNIKDKVVVITGASSGLGETTARHLASLGAKLVLGARRTERLEKLVADITAAGGQAIA
VTTDVARRDDVEALVAKGEQHFGRIDVLVNNAGIMPLAPMAKLKVEEWDRMIDVNVKGVL
YGVAAALPRFAAQSSGHIINVSSVAGIKVFAGMGTVYSATKFAVRALTEGLRTEAPDGVR
TTIISPGAVDSELKTHSSDKETSEALLAWYEANQIPSDSVARAIAYAIEQPANVDISEVV
LRPVAQEF