Protein Info for HSERO_RS01195 in Herbaspirillum seropedicae SmR1

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 8 to 104 (97 residues), 71.4 bits, see alignment E=3.7e-24 PF00528: BPD_transp_1" amino acids 29 to 210 (182 residues), 64.7 bits, see alignment E=4.9e-22

Best Hits

Swiss-Prot: 35% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0242)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV49 at UniProt or InterPro

Protein Sequence (215 amino acids)

>HSERO_RS01195 amino acid ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSEEQLLSLLQGAWGTVLLSGLTLLLGGMAGLALALARVSALRPLRRLAAAWIQLIQGTP
LLVLMGVCFYGPALAGVGTVEALPAAATAMLIYTSAFLGEIWRGCIQSVHKSQWEAAECI
GLSRWQRMRMIVLPQALRMATPPTVGFAVQVIKNTSVASLVIGFAELSYNAKVLNNSTFQ
PFLYFGSAALLYFAMCYPLSRWSRALERKLHAHRR