Protein Info for HSERO_RS01085 in Herbaspirillum seropedicae SmR1

Annotation: tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 199 to 218 (20 residues), see Phobius details PF04984: Phage_sheath_1" amino acids 191 to 362 (172 residues), 73.1 bits, see alignment E=2.4e-24 PF17482: Phage_sheath_1C" amino acids 370 to 465 (96 residues), 44.3 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 54% identical to TSP_BPBMU: Tail sheath protein (BcepMu39) from Burkholderia phage BcepMu (isolate -/United States/Summer/2002)

KEGG orthology group: K06907, (no description) (inferred from 100% identity to hse:Hsero_0220)

Predicted SEED Role

"Phage tail sheath monomer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV27 at UniProt or InterPro

Protein Sequence (480 amino acids)

>HSERO_RS01085 tail protein (Herbaspirillum seropedicae SmR1)
MPASYLHGVETIEIDKGPRPVQLVKTAVIGIVGTAAAGPVNTPILVSNERDFAQFGEDIA
GSTILDALQHIYQQKGTVCVVVNVLDPAIHKTSVVDEVVNVAADGSFRTSRPAIAAVSIK
SANGATVYTAGTDYQIDLRSGRGQRIGNGAIAASTVAAPTQLKISYSYADATKVTPADVI
GSVGASGQRLGMKALRDSYALFGFYPKILIAPVFASLASVSAELIATATALRAISFIDAP
IGVTPQQAITGRGPAGSINFNTSSDRVGLCYPYLKAFDASVGYDRLRPLSSFAAGAQSRK
DQDNGYWWSLSNTELLGATGVERPIDAMINDPNCEANLLNAAGVITVFNSFGTGLRIWGN
RSAAFPASTHPKNFLCVRRVADVIAESLEYFTLQYSDRPLDNALVDDVVESGNRFLRKLK
ADGAIIDGRAWYDPAQNDPTELAAGHLTITYDFMPPTPAERVSYRASINIDYLNQLGKKA