Protein Info for HSERO_RS00910 in Herbaspirillum seropedicae SmR1

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 4 to 175 (172 residues), 91.7 bits, E=2.4e-30
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 7 to 177 (171 residues), 275.3 bits, E=8.3e-87

Best Hits

Swiss-Prot: 91% identical to HSLV_JANMA: ATP-dependent protease subunit HslV (hslV) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 100% identity to hse:Hsero_0182)

MetaCyc: 67% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

See D8IUY9 at UniProt or InterPro

Protein Sequence (178 amino acids)

>HSERO_RS00910 peptidase (Herbaspirillum seropedicae SmR1)
MEQFHGTTILSVRRGNQVALGGDGQVTLGNIVMKGSARKVRKLYHGKVLVGFAGGTADAF
TLLELFEAKLEKHQGNLMRASVELAKDWRTDRMLRRLEAMLLCADKETTLVITGNGDVLE
PNDGIGAIGSGGSYAQSAAKALYENTELSPAEIVKKSLTIAGELCIYTNLNHIIETLE