Protein Info for HMPREF1078_RS17550 in Parabacteroides merdae CL09T00C40

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 246 to 277 (32 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 5 to 219 (215 residues), 82 bits, see alignment E=1.2e-26 PF00535: Glycos_transf_2" amino acids 7 to 166 (160 residues), 105.9 bits, see alignment E=4.6e-34 PF10111: Glyco_tranf_2_2" amino acids 7 to 220 (214 residues), 56.1 bits, see alignment E=8.6e-19 PF13632: Glyco_trans_2_3" amino acids 85 to 273 (189 residues), 40.7 bits, see alignment E=5e-14

Best Hits

KEGG orthology group: None (inferred from 69% identity to bhl:Bache_0339)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>HMPREF1078_RS17550 glycosyltransferase (Parabacteroides merdae CL09T00C40)
MATSHLSLIIPVYNRPNEVEELLDSLTRQSETNFEVVIVEDGSKETCQHVVEAFKDKLDV
SYSYIPNGGPGNARNYGAKQSKGDYLIVLDSDCILPPDYIKSVNKELKETGADAFGGPDK
ASDSFTDVQKAINYSMTSFFTTGGIRGGKKKMDKFYPRSFNMGIRKSTYEALGGFSPMRF
GEDIDFSIRLFKNGNKVCLFPSAWVYHKRRTDWHKFFRQVYNSGIARINLYKKYPDSLKL
VHLLPAAFTLGVLFFLVGSLFCTWSLLPLGLFCLLIFADSSIQNKSIKIGFLSIIASFIQ
LSGYGCGFLDAAWNRLVLKKEEFSAFQKTFYK