Protein Info for HMPREF1078_RS15845 in Parabacteroides merdae CL09T00C40
Annotation: copper homeostasis protein CutC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 93% identical to CUTC_PARD8: Copper homeostasis protein CutC (cutC) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
KEGG orthology group: K06201, copper homeostasis protein (inferred from 93% identity to pdi:BDI_0272)Predicted SEED Role
"Cytoplasmic copper homeostasis protein cutC" in subsystem Copper homeostasis: copper tolerance
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (245 amino acids)
>HMPREF1078_RS15845 copper homeostasis protein CutC (Parabacteroides merdae CL09T00C40) MKPTRIIEICANSAQSCVEAEAGGAKRVELCAGIPEGGTTPSYGEIRTAQALTSSIDINV IIRPRGGDFLYTPAEIQSMLLDIELCKQLKVHGVVFGCLTKDGDIDVPLMRRLIETAKPL SVTCHRAFDVCRDPFAALEQLIELGCDRILTSGQQSDAVKGIPLIAELVKRAAGRIIIMP GCGVRENNIARIEAETGAKEFHTSARSIVYSKMEYRNENVPMGSSIVSSEFETVETDRKK VASYL