Protein Info for HMPREF1078_RS14975 in Parabacteroides merdae CL09T00C40

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 59 to 81 (23 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details PF01252: Peptidase_A8" amino acids 12 to 190 (179 residues), 117.7 bits, see alignment E=2.5e-38

Best Hits

Swiss-Prot: 57% identical to LSPA_PORG3: Lipoprotein signal peptidase (lspA) from Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 89% identity to pdi:BDI_0450)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>HMPREF1078_RS14975 lipoprotein signal peptidase (Parabacteroides merdae CL09T00C40)
MRYSKGWGAALIVMLLLILDQALKIWIKTHMQLHESIEITPWFYLYFTENPGMAFGIEVI
GKLFLSVFRIIAVGFIGYYLYKLVKQNYAFGFIACISLIFAGAIGNIIDSIFYGVVFDHS
FGQVASFMPEGGGYASWLHGKVVDMFYFPLIQTVLPEWIPVWGGEEFIFFRPIFNLADSA
ICVGVFLLLLFYRHTLSTSLSKEK