Protein Info for HMPREF1078_RS14865 in Parabacteroides merdae CL09T00C40

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 PF05970: PIF1" amino acids 13 to 204 (192 residues), 95.9 bits, see alignment E=1.7e-30 PF13604: AAA_30" amino acids 15 to 163 (149 residues), 36.8 bits, see alignment E=2.1e-12 PF13245: AAA_19" amino acids 21 to 162 (142 residues), 45 bits, see alignment E=7.4e-15 PF13432: TPR_16" amino acids 543 to 576 (34 residues), 15.6 bits, see alignment (E = 1.1e-05) amino acids 572 to 629 (58 residues), 26.4 bits, see alignment 4.8e-09 amino acids 614 to 664 (51 residues), 20.8 bits, see alignment 2.6e-07 PF13181: TPR_8" amino acids 565 to 596 (32 residues), 14.1 bits, see alignment (E = 2.7e-05) amino acids 599 to 631 (33 residues), 29.6 bits, see alignment (E = 2.8e-10) PF07719: TPR_2" amino acids 599 to 631 (33 residues), 24 bits, see alignment (E = 1.8e-08)

Best Hits

KEGG orthology group: None (inferred from 85% identity to pdi:BDI_2311)

Predicted SEED Role

"putative helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (667 amino acids)

>HMPREF1078_RS14865 tetratricopeptide repeat protein (Parabacteroides merdae CL09T00C40)
MEFQLDTDNKEFQDALQLITHTRQSVFLTGKAGTGKSTFLKYICAHTKKKYVVLAPTGIA
AINAEGVTLHSFFKLPFRPMLPDDPDLSLKNGRIFEFFKYRKEHRKLISEVELIIIDEIS
MVRADIIDCVDRILRVFSGNMRLPFGGKQLLFVGDVFQLEPVVPADQKEILSLFYASPFF
FSARVFKDINLVPIELQKVYRQTDPVFINILDRIRSNIARKQELDTLNARYFPDFIPRNE
DMYITLATRRDQVDFINERKLGELPGEEFVSHGKIEGDFPESSLPTQLNLSIKEQAQVIF
IDNDYERRWVNGTIGMVSGIDENGNVYVLLEDGREYLVEPTSWRNYKYKYNEKEKKVEEE
IVGTFEQLPIRLAWAITVHKSQGLTFSRVVVDLTGGVFAGGQTYVALSRCTSLEGLVLKS
RISPHDIFVRKEIVQFSQMFNDRQLIEKSLRESEAELLYARAARCFKSGNVKEMVEAFAA
AVSKRNELEKPEVQRLLRMKLQTMNTQRAQIKKLREEIHAQREIQKEYAHEYYLMGNECI
TKAHDPNAAIRSFDKALKLYPEFVDAWVRKGVTLLDMGDGFQAVTCLNEAVRLNPKSFKA
RYNRGKSYLQLKYYDEAVSDFMKAVDLKPKHAAAHEYLAEAFLHIGEEELARQHQDIADD
LRNGNEN