Protein Info for HMPREF1078_RS13680 in Parabacteroides merdae CL09T00C40

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01763: malate dehydrogenase, NAD-dependent" amino acids 2 to 305 (304 residues), 370.3 bits, see alignment E=3.5e-115 PF00056: Ldh_1_N" amino acids 3 to 143 (141 residues), 144.7 bits, see alignment E=2e-46 PF02866: Ldh_1_C" amino acids 148 to 305 (158 residues), 95.5 bits, see alignment E=3.9e-31

Best Hits

Swiss-Prot: 99% identical to MDH_PARD8: Malate dehydrogenase (mdh) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 99% identity to pdi:BDI_0389)

MetaCyc: 41% identical to malate dehydrogenase subunit (Methylorubrum extorquens AM1)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>HMPREF1078_RS13680 malate dehydrogenase (Parabacteroides merdae CL09T00C40)
MSKVTVVGAGNVGATCANVLAFNEVADEVVMLDVKEGVSEGKAMDMMQTAQLLGFDTTVT
GCTNDYEKTANSDVVVITSGIPRKPGMTREELIGVNAGIVKSVAQNILKYSPNAILVVIS
NPMDTMTYLSLKSLGLPKNRIIGMGGALDSSRFKYFLSQALGCNANEVEGMVIGGHGDTT
MIPLARLATYKGIPVSKLLSAEKLQEVVASTMVGGATLTKLLGTSAWYAPGAAGAYVVES
IIHNQKKMVPCSVYLEGEYGESDLCIGVPVILGKNGIEKIVELELTAEEKELFAKSAAAV
HKTNEALKEVGAL