Protein Info for HMPREF1078_RS12075 in Parabacteroides merdae CL09T00C40

Annotation: bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 6 to 203 (198 residues), 230.3 bits, see alignment E=1.6e-72 PF00926: DHBP_synthase" amino acids 10 to 202 (193 residues), 274.7 bits, see alignment E=3.6e-86 PF00925: GTP_cyclohydro2" amino acids 214 to 377 (164 residues), 247.2 bits, see alignment E=6.3e-78 TIGR00505: GTP cyclohydrolase II" amino acids 215 to 401 (187 residues), 250 bits, see alignment E=1.3e-78

Best Hits

Swiss-Prot: 96% identical to RIBBA_PARD8: Riboflavin biosynthesis protein RibBA (ribBA) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K14652, 3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC: 3.5.4.25 4.1.99.12] (inferred from 96% identity to pdi:BDI_3492)

MetaCyc: 46% identical to GTP cyclohydrolase II (Chlamydia trachomatis)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase (EC 4.1.99.12) / GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25, EC 4.1.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.25 or 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>HMPREF1078_RS12075 bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II (Parabacteroides merdae CL09T00C40)
MSEIKLNTIEEAIEDFREGKFLIVVDDEDRENEGDFIIAAEKITPEKVNFMLKNGRGVLC
APITEERCQELELDMQVANNTSLLGTPFTITVDKLGGGCTTGVSMFDRAETILALADPKT
KPSDLGRPGHINPLRARSRGVLRRAGHTEAAVDLARLAGLYPAGALIEIINEDGTMARLP
QLIEVAKKFDIKIICIKDLISYRLKTESIVENGVEVDLPTQYGHFRLIPFRQKSNGLEHI
ALIKGRFEPDEPILVRVHSSCATGDIFGSMRCECGEQLHKAMQRIEQEGKGVIVYLNQEG
RGIGLMEKMKAYKLQEDGLDTVDANLHLGHQADERDYGVGAQILRHLGVTKMRLMTNNPV
KRVGLEAYGLTVVENVPIEVAPNPYNEFYMKTKKERMGHVLHNIK