Protein Info for HMPREF1078_RS11835 in Parabacteroides merdae CL09T00C40

Annotation: ribonuclease HII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF01351: RNase_HII" amino acids 13 to 189 (177 residues), 141.9 bits, see alignment E=1.3e-45

Best Hits

Swiss-Prot: 86% identical to RNH2_PARD8: Ribonuclease HII (rnhB) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03470, ribonuclease HII [EC: 3.1.26.4] (inferred from 86% identity to pdi:BDI_3545)

MetaCyc: 49% identical to RNase HII (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>HMPREF1078_RS11835 ribonuclease HII (Parabacteroides merdae CL09T00C40)
MLLSYLEANRIEAGCDEAGRGCLAGSVYAAAVILPPDFHNEDLNDSKQLSEKKRYALRPI
IEREAIAWAVGIVTPEEIDRINILKASFLAMHRAIDQLKVKPEHLLIDGNRFTPYPGLKH
TTVVKGDGKYLSIAAASILAKTYRDDYMDSLDREYPAYHWKENKGYPTKAHREAIRECGI
TPYHRKTFTLLPEQLELQF