Protein Info for HMPREF1078_RS11655 in Parabacteroides merdae CL09T00C40

Annotation: FprA family A-type flavoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF00753: Lactamase_B" amino acids 34 to 202 (169 residues), 52 bits, see alignment E=1.8e-17 PF19583: ODP" amino acids 34 to 226 (193 residues), 79.9 bits, see alignment E=4.8e-26 PF00258: Flavodoxin_1" amino acids 254 to 383 (130 residues), 53.4 bits, see alignment E=6.5e-18

Best Hits

KEGG orthology group: None (inferred from 87% identity to pdi:BDI_3567)

Predicted SEED Role

"Alkyldihydroxyacetonephosphate synthase (EC 2.5.1.26)" (EC 2.5.1.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>HMPREF1078_RS11655 FprA family A-type flavoprotein (Parabacteroides merdae CL09T00C40)
MYKLKEIADKVYYVGVNDRQKALFENMWPLPYGVSYNSYLIVDEKTVLVDTVDVCYSDIF
LKKIADALDGRPLDFLIVNHMEPDHAGSIRLLRQQYPDVQIVGNKQTFGMLNGYHGISTG
LYEVKEGDTLSVGRHQLSFYMAPMVHWPEVMVTYDSTDKILFSADAFGTYGTLDGGVIDS
EMNVEHYWEEMLRYYSNIVGKYGNPVQRALQKLSALDIRTICSTHGPVWREYAAKAIDIY
DRMSRYEGEEGVTIVYGSMYGNTEQMAEAIAASLAANGVKNIVMHNVSKSPASYVLKDIF
KYKGLIIGSPTYSNRLFPEIESILDKIETREVKHRLYGYFGSFTWAGAAVKNLAAFGEKM
KWEVVGVPVEQKQALKADKYEECWALGEEMAKKLKTEN