Protein Info for HMPREF1078_RS11545 in Parabacteroides merdae CL09T00C40

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 61 to 353 (293 residues), 255.1 bits, see alignment E=4.7e-80 PF00595: PDZ" amino acids 95 to 165 (71 residues), 36.3 bits, see alignment E=1.5e-12 PF13180: PDZ_2" amino acids 105 to 176 (72 residues), 32.4 bits, see alignment E=2.2e-11 PF17820: PDZ_6" amino acids 118 to 166 (49 residues), 42.4 bits, see alignment 1.2e-14 PF03572: Peptidase_S41" amino acids 198 to 353 (156 residues), 158.6 bits, see alignment E=2.7e-50 PF28547: CHD_PDZ-protease" amino acids 406 to 541 (136 residues), 145.5 bits, see alignment E=3.1e-46

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 73% identity to pdi:BDI_3657)

Predicted SEED Role

"Putative carboxy-terminal processing protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>HMPREF1078_RS11545 S41 family peptidase (Parabacteroides merdae CL09T00C40)
MYKQREKIIVLFSLLLLLGGVIPGQAQKDNRFEVSKNLDIFNALVKEVEMFYVDSVDVEK
TVRRGIDAMLGGLDPYTEYYPEQEMDKLKFMTTGEYGGIGSYIRERKEGGVYIIEPFEGM
PAALAGLKAGDRILAIDTVDVTDKSSDEVSALLKGVPNTKMVLKIQSPYDKKPREVELVR
RQILENQVTYYGVRGDSVGYIYLKGFTDKSAQEVKNAFEDLKKNHHIKSLILDLRNNGGG
LLESATQIVGMFVPKGKEVVSTKGKISQWDRTYRTPGEPLDTVMPMAVLINGASASAAEI
VSGSLQDMDRAVLIGQRSFGKGLVQSPRELPYNGSVKVTMSKYYIPSGRCIQQMDYSHRK
ADGSVGAIPDSLTSVFYTSKGRPVRDGGGITPDFKIEEPETPTMMFYLVTDFLLTDFVAE
WSQKHKKIAPPEDFEVTDEDFEAFKQYAKEKNFTYDRQSEKLLKNLKEVAKFEGYMDNDS
TIFNSLEAKLTPDLDRDFDRNKDQIKKLLTSEIMKRYYFQKGELINSLKEDDVLDKALEV
LGDPALYQQTLEAPGKVEKTATL