Protein Info for HMPREF1078_RS10710 in Parabacteroides merdae CL09T00C40

Annotation: monomeric [FeFe] hydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04105: [FeFe] hydrogenase, group B1/B3
  • amino acids 4 to 464 (461 residues), 523.6 bits, E=2e-161
• PF12838: Fer4_7
  • amino acids 120 to 166 (47 residues), 30.4 bits, 2e-10
  • amino acids 174 to 212 (39 residues), 33.4 bits, 2.3e-11
• PF12837: Fer4_6
  • amino acids 145 to 167 (23 residues), 26.6 bits, see alignment (E = 1.9e-09)
  • amino acids 192 to 213 (22 residues), 28.8 bits, see alignment (E = 3.8e-10)
• PF13237: Fer4_10
  • amino acids 146 to 209 (64 residues), 25.4 bits, E=5.4e-09
• PF00037: Fer4
  • amino acids 146 to 167 (22 residues), 27.2 bits, see alignment (E = 1.1e-09)
  • amino acids 193 to 213 (21 residues), 39 bits, see alignment (E = 2.2e-13)
• PF13187: Fer4_9
  • amino acids 174 to 213 (40 residues), 27 bits, 1.6e-09
• PF02906: Fe_hyd_lg_C
  • amino acids 231 to 461 (231 residues), 194 bits, E=1.5e-60

Best Hits

KEGG orthology group: None (inferred from 92% identity to pdi:BDI_0006)

Predicted SEED Role

"Periplasmic [Fe] hydrogenase (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

• superpathway of hydrogen production (2/2 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (2/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Protein Sequence (481 amino acids)

>HMPREF1078_RS10710 monomeric [FeFe] hydrogenase (Parabacteroides merdae CL09T00C40)
MAFTNNVMIVRHGLLAKLVKLWKENRLLEEIDRLPIELSPRKSKVIGRCCVHKERAVWKY
KTLPLLGFDMQDEVDELTPLSEYAKQALLRSENKKENLMCVVDEACSSCVQVNYEITNLC
RGCVARSCYMNCPKDAIRFKKNGQAEIDHDTCISCGKCHQNCPYHAIVYIPIPCEEVCPV
KAISKDEYGVEHIDESKCIYCGKCVNACPFGAIFEISQVFDILQRLRNKEPMVAIVAPSI
LAQFAAPVEKVYGAIKSLGFLEVVEVAQGAMETTRHEAEELKEKLAEGQPFMTTSCCPSY
IQLAEKHIPDLKKYISTTGSPMYYTARIVKEKYPDAKIVFVGPCVAKRKEVKMDPCVDFT
LTFEEVGSVLAGMDIKIEEAQPFTVLRNSVREAHGFAQAGGVINAVKVYLKEDQDASLNT
IQVANLTKKNVALLRAYAKTGKAPGQFIEVMACEGGCVTGPCVHGDRSAGQKQLLKELTK
Y