Protein Info for HMPREF1078_RS10140 in Parabacteroides merdae CL09T00C40

Annotation: nucleoside transporter C-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 379 to 404 (26 residues), see Phobius details amino acids 415 to 439 (25 residues), see Phobius details PF01773: Nucleos_tra2_N" amino acids 18 to 91 (74 residues), 77.9 bits, see alignment E=1e-25 PF07670: Gate" amino acids 102 to 200 (99 residues), 54 bits, see alignment E=3.2e-18 PF07662: Nucleos_tra2_C" amino acids 213 to 434 (222 residues), 232 bits, see alignment E=9.8e-73

Best Hits

KEGG orthology group: K03317, concentrative nucleoside transporter, CNT family (inferred from 79% identity to pdi:BDI_1825)

Predicted SEED Role

"Nucleoside permease NupC" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>HMPREF1078_RS10140 nucleoside transporter C-terminal domain-containing protein (Parabacteroides merdae CL09T00C40)
MIEQQLGFSLESFLRGIVGISTVLGVAYLMSYDRKRVDWKLVGGGLFMQFVFALAVLYVP
VVGIVLEWVGKAFIKLMDFTQSGVAFLLGPLVTKSEGFIFLLNSLPVVIFFSALVSLFYY
WGIIQRVVGGFSWLLRRFMNISGAEGLVASGNVFLGMTESPVLIKNYLPAMNRSEIFLVM
VSGMGTIAGTVMGTYIGMLAGGDPVSRVLFAKHLLSASLMAAPGSIVLAKILCPQTEKVD
DRLVKMEKVGQHSTVLDALAAGTSTGVRLMVNIAAMLLVFIAMVALANYILEGVIGRYTG
LNDWIVSITDGKAQGLTFQFILGVILSPFMWLIGVPYQDVMLVGSLLGQKTILNEFVAYF
QLQEWKDAGLFLYQKSILMSTYILCGFANISSIGILLGGMGVLAPEKRELITRFGFPAMI
AGALVSVLSATIIGMMLIVN