Protein Info for HMPREF1078_RS10125 in Parabacteroides merdae CL09T00C40

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 7 to 80 (74 residues), 29.7 bits, E=2e-10
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 125 to 435 (311 residues), 457.6 bits, E=1.1e-141
• PF02540: NAD_synthase
  • amino acids 134 to 192 (59 residues), 25.6 bits, E=2.6e-09
• PF00733: Asn_synthase
  • amino acids 135 to 162 (28 residues), 22.2 bits, see alignment (E = 4.2e-08)
• PF02568: ThiI
  • amino acids 141 to 197 (57 residues), 21.2 bits, 7.8e-08
• PF01171: ATP_bind_3
  • amino acids 142 to 205 (64 residues), 28.4 bits, E=5.4e-10
• PF03054: tRNA_Me_trans
  • amino acids 142 to 176 (35 residues), 21.5 bits, 6.5e-08
• PF00958: GMP_synt_C
  • amino acids 343 to 434 (92 residues), 121.2 bits, E=6.3e-39

Best Hits

Swiss-Prot: 92% identical to GUAA2_BACTN: Putative GMP synthase [glutamine-hydrolyzing] 2 (guaA2) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 94% identity to pdi:BDI_1828)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (20/26 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of purine nucleotide salvage (10/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (5/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (435 amino acids)

>HMPREF1078_RS10125 glutamine-hydrolyzing GMP synthase (Parabacteroides merdae CL09T00C40)
MKQDMIVILDLGSHENTVLARAIRALGVYSEIYPHDITVEELKALPNVKGIIINGGPNNV
IDGVAIDVNPGIYSIGIPVMAAGHDKALCEVKLNEFSSDMEAIKESVKTFVFDTCKAEAN
WNMTNFVNDQIELVRRQVGDRKVLLALSGGVDSSVVAALLLKAIGDKLVCVHVNHGLMRK
GESENVVEVFKNQLNANLIYKDVTDRFLDKLAGVADPEEKRKIIGGEFIRVFEEEARKLD
GIDFLAQGTIYPDIVESGTKTAKMVKSHHNVGGLPEDLKFELVEPLRQLFKDEVRACGLE
LGLPYEMVFRQPFPGPGLGVRCLGAITRDRLEAVREADAILREEFQKAGLDKKVWQYFTV
VPDFKSVGVRDNARSFEWPVIIRAVNTVDAMTATIEPVDWHILMKITDRILKEVKNVNRV
CYDMSPKPNATIEWE