Protein Info for HMPREF1078_RS10095 in Parabacteroides merdae CL09T00C40

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 28 to 378 (351 residues), 141.6 bits, see alignment E=3.6e-45 PF01061: ABC2_membrane" amino acids 205 to 345 (141 residues), 27.1 bits, see alignment E=2.9e-10

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 77% identity to pdi:BDI_0142)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>HMPREF1078_RS10095 ABC transporter permease (Parabacteroides merdae CL09T00C40)
MNNEKLNSTPKLSIAKREIFRICKDPVYFFCMLVAPTICVVFFLSLMKEGLPTDMPVAVV
DLDGSSNSRNLARQLDAFEQTKVMLTTVSFEEARQAMQEGKVYGIFYIPKDFGVDATAGR
QPKLSFYTNGTYLIAASLLFRDMKTMSVLAGASVGLQTGLAHGYTENQIMAQLQPIVIDT
HAIGNPWLNYSVYLNNTLLPGVLQLMIFLVTVLSIGSEIKYSTAREWLQMGGNSLTVSLI
GKIFPHTVIFTIVAFLYAVALYGFNSFPLNSGWLPMLSALFLLVIASQAVGIFMIGVLPT
FRLGLSSACLFGMIAFSIVGFSFPVLRMDPTLQALSNLFPLRHYFLIYVDQALNGRPFFY
SWAEYAWLMGFLVLPFLIGKNLKNALLYFKYIP