Protein Info for HMPREF1078_RS09995 in Parabacteroides merdae CL09T00C40

Annotation: U32 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 PF01136: Peptidase_U32" amino acids 16 to 306 (291 residues), 323.5 bits, see alignment E=1.2e-100 PF12392: DUF3656" amino acids 382 to 494 (113 residues), 75.5 bits, see alignment E=5.4e-25

Best Hits

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 79% identity to pdi:BDI_1489)

Predicted SEED Role

"Putative collagenase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>HMPREF1078_RS09995 U32 family peptidase (Parabacteroides merdae CL09T00C40)
MQTKSRPIELLSPAKDLNCGIEAINHGADAVYIGAPKFGARSAAGNSLDDIRELCEYAHL
YGARIYVTLNTILKEDELEEAERMIWDLWRVGTDALIIQDMGITRLNLPPIPLHASTQTD
NRTPEKVRFLEAAGFTQVVLARELSLNEIRRTSEATTVPLEVFVHGALCVSYSGQCYLSA
ALSGRSANRGECAQYCRLPYTMVDATGTEIVSNKHLLSLKDMNRSDQLEALLDAGVSSLK
IEGRLKDAGYVKNITAYYRKKLDAVLSRRPEYRRASAGRSTYTFEPVAEKSFNRGFTTFL
LEGRTADITAFNTPKSLGEPVGMVKEIKGNSFTVAGLKQLNNGDGLVFFNRKGELEGFRV
NRVEANRVFPLDMPQLTPKTPLYRNFDQAFDKLLAKPSAERKLSVEIEFLDNPFGFTLCM
EDETGARIMLTEPFAKELARREQQDNIRTQLSKLGNTPFEASKVVVGLSENWFVPSSLLA
DMRRRGVEKLLEARRARYPRETVKRVQPSVSIPFPERQLTYLGNVANGKARSFYQDHGVE
QIDPAFELSPRKDVPLMFTKHCLRYSMGWCPTYQKDKSPYKEPYYLLYKDTRLRLQFDCK
HCQMLVFES