Protein Info for HMPREF1078_RS09610 in Parabacteroides merdae CL09T00C40

Annotation: outer membrane beta-barrel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 805 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 26 to 99 (74 residues), 37 bits, see alignment E=9.1e-13 PF13715: CarbopepD_reg_2" amino acids 26 to 86 (61 residues), 33.2 bits, see alignment 1e-11 PF07715: Plug" amino acids 146 to 212 (67 residues), 24.8 bits, see alignment E=6.6e-09 PF00593: TonB_dep_Rec" amino acids 322 to 784 (463 residues), 75.7 bits, see alignment E=1.7e-24 PF14905: OMP_b-brl_3" amino acids 378 to 781 (404 residues), 296.5 bits, see alignment E=9.3e-92

Best Hits

KEGG orthology group: None (inferred from 65% identity to pdi:BDI_3013)

Predicted SEED Role

"TonB-dependent receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (805 amino acids)

>HMPREF1078_RS09610 outer membrane beta-barrel family protein (Parabacteroides merdae CL09T00C40)
MKKCFCLLLTLLCISYSAVAAPGFRIKGKIVDANNNQPIDFADVLLFREGDVNPVFHALP
DRDGTFRIADVKDGKYNLLVRLVGYDLYNRPGIVLDAVSKAVDLGTIAMKPLEVGLAEVE
VVAQKKQVIYKLDKKVIEASSNLLAGGGSAVDILENTPSIRVDAEGEVSFRGSTGFTVYV
DGKPSVFSGTQALEQIPAGHIENIEIITTPSARHDTGGDVGIINIVTKKHAQHGFSGMVN
LTGSTVLSRGVDFLVSQQNKASRWYLGGVWSDRLRKSDFDQEKTTIISDTATTSHSNGPR
KSNNFNYSMKAGWMYTLPHTTLNADFEGGYGGRTRNGDLDYKEKRLAGGATFGEGDYYSR
DDYDLHETYFQGTIGFDHKFDDKGHQLMGSFYLKYGGNAMEYFQSDLFNKNNEREKGHRA
WEDEHRWTVRGNLDYIYPYSKTGRIEGGYQYFSYLEDGDYTMHFWDPVKKEFYNRDDIYN
TFYFQHGINSVYAIVADSYKSFDFQAGVRGEHTHRVLRSSIPGKDRTYNKFEFFPSLHLG
YTFPKEHKLLVSYSRRITRPELFFMEPYITYRDFYSAEIGNPDIRSEYINSFELNYKKNI
GEHTVSATVFHRNRKDKIERLRVPYEAGVTLDSMANVGHDYSTGIELSGQVQLTRWWNMN
LNGSLYHYKVKNRYKTGSEKETSTNYDVMWNNSFDVFKYTRIQVDGNFVGPSVTTQGRTD
AFWYVNLAVRQQLMNRRLSATLSFRDVFNSARYVSKIITSDLQSITRIRPSYPLITLTLS
YTFNNFKAKSSQKKEDHDLFEGTNH