Protein Info for HMPREF1078_RS08465 in Parabacteroides merdae CL09T00C40

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00583: Acetyltransf_1" amino acids 48 to 153 (106 residues), 34.6 bits, see alignment E=4.2e-12 amino acids 241 to 325 (85 residues), 46.1 bits, see alignment E=1.1e-15 PF13302: Acetyltransf_3" amino acids 187 to 326 (140 residues), 71.8 bits, see alignment E=1.9e-23 PF13420: Acetyltransf_4" amino acids 247 to 333 (87 residues), 26.3 bits, see alignment E=1.4e-09

Best Hits

Predicted SEED Role

"Ribosomal-protein-L7p-serine acetyltransferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>HMPREF1078_RS08465 GNAT family N-acetyltransferase (Parabacteroides merdae CL09T00C40)
MAISSIPSDIFRKAEETDIERIWQIIGQAKAQMQRLGSQQWDENYPAIEHIRQDIQDGNG
YVICREDRVVAYGVISFDGEPVYKDIEGKWSNDLPYVIVHRLAIADEMKRQGMAKQFMLQ
AEEVSRKKGVYNFRVDTKYDNAYMLRLIDTLGFKYCGEVYYRNNSARKAFEKTIRPYSHP
IGISDYTIREATFEDATLIFEAIDKNREDLRIWLPFIDGLKSVADEQGFLQSVLAVPYEQ
RDPVYILEQGEAICGLAGFHFSDAPNRRTEIGYWLLPAYRGKGIVTNTVRYLCQWAVRER
NMNRIQIRCAVGNIPSNAVPKRLGFTLEGTEREGELLTSGEYVNVNVYSILKKEIEQWNR
KSN