Protein Info for HMPREF1078_RS08430 in Parabacteroides merdae CL09T00C40

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 39 to 365 (327 residues), 241.5 bits, see alignment E=5.6e-76 PF25973: BSH_CzcB" amino acids 62 to 201 (140 residues), 38.7 bits, see alignment E=1.5e-13 PF25917: BSH_RND" amino acids 63 to 194 (132 residues), 33.5 bits, see alignment E=6e-12 PF25944: Beta-barrel_RND" amino acids 220 to 290 (71 residues), 37 bits, see alignment E=7.5e-13

Best Hits

KEGG orthology group: K03585, membrane fusion protein (inferred from 83% identity to pdi:BDI_0274)

Predicted SEED Role

"multidrug resistance protein; HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>HMPREF1078_RS08430 efflux RND transporter periplasmic adaptor subunit (Parabacteroides merdae CL09T00C40)
MTRRLFFNYLPFLFLIASFFTSCNRSHEKKSGSKDNTLVVKLVATSIEVAQSYVADVQAV
QFVEVKPKVEGFVEDVLVDEGEHVKKGQVLFKLSSAELYEEVKEAQANYKQVQAELKMAE
VEADRVKRLVEKDIISPIRLEQALAEADVARLRVQQAKSRLLRAETNYSYTTITSPFEGY
VDRIPFKVGSLVTPSSLLTSLTDVSEMFAYFKINEKEYLEYKRTQLSGVEQPEYNNLELI
LSDQTTYPYKGTVETVEGDFERGTGSIAFRARFANPDRLLRHGVSGKIRMLTEMEDVILV
PQRSTFEIQDFTYVYTVDEEGKVSVRSFEPLSRHGAYYVTKDLPDNTLIVYEGVQQVSDG
MVITPEIVDAETVRKQLELSDEVENNK