Protein Info for HMPREF1078_RS08280 in Parabacteroides merdae CL09T00C40

Annotation: carboxymuconolactone decarboxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02627: CMD" amino acids 23 to 86 (64 residues), 26.5 bits, see alignment E=1e-09 amino acids 142 to 210 (69 residues), 45.1 bits, see alignment E=1.6e-15 PF02129: Peptidase_S15" amino acids 249 to 422 (174 residues), 37.1 bits, see alignment E=5.9e-13 PF01738: DLH" amino acids 266 to 368 (103 residues), 24.8 bits, see alignment E=3e-09

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 100% identity to bth:BT_1121)

Predicted SEED Role

"Dienelactone hydrolase and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>HMPREF1078_RS08280 carboxymuconolactone decarboxylase family protein (Parabacteroides merdae CL09T00C40)
MNKLITTIACLICCIVYTQAQNKDNMLSKKEQSIAAISMYAARGNQDSLKVILARGLDCG
LTVSEEKEVLTQLYAYCGFPRSMGALVTLMNLTKERAAQGIKDEAGREPSPVKSSDMFVV
GGQNQLKLFGRPALGEVLTFAPALDQFLKAHLFGDIFSRDNLDWRTRELSTVAALSVLDG
VKNELNTHIAHAKHNGVTQAQIDEVLIMAARCRNGMVLSESDEPAKTFQTDPTITVRKVF
YKNRYDIMLCAEMYLPKDFNEAQHYAALIIGHPFGAVKEQCSGLYAQEMARRGYVTLAFD
ASYQGESGGEPRHTVSPDALVEDFSASVDWLGLQPFIDRNRIGVIGICGSGGFSVCAASL
DPRIKALATVSMYDMGRATRNGLGDSMTDEQRRKLLDEVAEQRWKEAETGEARIRFGTPE
KLLGNANAVQKEFFDYYRNPLRGYHPRYQGIRFTSQAALMNFYPFAMIKEISPRPVLFIA
GEHAHSRYFSEDAYQEASEPKELYIVPGANHVDLYDPDG