Protein Info for HMPREF1078_RS08110 in Parabacteroides merdae CL09T00C40

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 10 to 11 (2 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 253 (176 residues), 62.1 bits, see alignment E=2.9e-21

Best Hits

KEGG orthology group: K11070, spermidine/putrescine transport system permease protein (inferred from 92% identity to bhl:Bache_2701)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>HMPREF1078_RS08110 ABC transporter permease (Parabacteroides merdae CL09T00C40)
MMTKWMAKGYLWLLLVLLYSPILIIMIFSFTEAKVLGNWTGFSTKLYSSLFTGGVQRSLV
SALWNTFAIAMIAATVSTLLGSIAAIGIFNLRSRTRQVMNFANAIPMMNADIITGVSLFL
LFVSFGVSQGFTTVVLAHITFCTPYVVLSVMPRLKKMNQNVYEAALDLGATPFQALRKVI
LPEIRPGMISGFILAFTLSIDDFAVTIFTIGNEGLETLSTFIYADARKGGLTPELRPLST
IIFVTVLVLLIVINKRAEKSKS