Protein Info for HMPREF1078_RS07865 in Parabacteroides merdae CL09T00C40

Annotation: asparaginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00519: L-asparaginase, type I" amino acids 9 to 345 (337 residues), 319 bits, see alignment E=1.6e-99 PF00710: Asparaginase" amino acids 10 to 198 (189 residues), 208.4 bits, see alignment E=7.9e-66 PF17763: Asparaginase_C" amino acids 220 to 334 (115 residues), 119 bits, see alignment E=1.1e-38

Best Hits

KEGG orthology group: K01424, L-asparaginase [EC: 3.5.1.1] (inferred from 84% identity to pdi:BDI_1705)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.1

Use Curated BLAST to search for 3.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>HMPREF1078_RS07865 asparaginase (Parabacteroides merdae CL09T00C40)
MNVCKDDASILIIYTGGTIGMIENPETGSLEAFNFEHLEEHVPELKNLGYKISSIQFDPP
MDSSEMGPDSWMKIVHVIAEHYHDYDGFVVLHGTDTMAFTASALSFMLENLSKPVVLTGS
QLPIGMLRTDGKENLITAIEIAAARENDMPLVPEVCIFFENDLLRGNRTSKTNADNFNAF
RSYNYPPLAHAGISIKYDVSQVYHPVSRKPLKPHYLLDRNIAILKIFPGISPQVVESILN
IPGLKGVVMETFGSGNAPGYDWLLEMLKDAVERGIVIVNVTQCLAGSVEMHRYETGRKLL
QAGVVSGYDSTTECAVAKLMFLFGHGMTPDEVKEHLNCSLIGEITIA