Protein Info for HMPREF1078_RS07685 in Parabacteroides merdae CL09T00C40

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 35 to 369 (335 residues), 228.9 bits, see alignment E=3.8e-72 PF16576: HlyD_D23" amino acids 56 to 287 (232 residues), 49.9 bits, see alignment E=5.1e-17 PF13533: Biotin_lipoyl_2" amino acids 68 to 106 (39 residues), 26.4 bits, see alignment 9.2e-10 PF02321: OEP" amino acids 97 to 165 (69 residues), 31.5 bits, see alignment E=3.1e-11 PF13437: HlyD_3" amino acids 170 to 284 (115 residues), 34 bits, see alignment E=8e-12

Best Hits

KEGG orthology group: None (inferred from 75% identity to pdi:BDI_1737)

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>HMPREF1078_RS07685 efflux RND transporter periplasmic adaptor subunit (Parabacteroides merdae CL09T00C40)
MKTAIKIGMMGLSIVLLAGCKEKSHQTEMPAPSISVAMPVVRDITLTKDYPGYLSSDRMV
NLVARVNGYLQSSQLVPGAKVKKGDLIFVIEPEVYQNNVTQAEAALNTAKAQVEYARSNY
ERMKEAAKSGAVSQIQVLQAESTAAEMEASVHNAEAALKTARTNLGYCYIRAPYDGRVTR
ASYDVGNYINGAVQPVTLATLYKDDIMYANFNIEDNQFMRMKMIADQNDPNVKMPTHVSI
RLGQDGRQSYTGTLDYLSPNVDLSTGTLNVRANLENKDGELKSGLYVTITLPYSEQKDAV
LVRDASIGTDQLGKFLYIVNDSNIVRYRHIEPGQLVDDTLRQVISGIRPDERYVTTALLK
VRDGMSIKPIK