Protein Info for HMPREF1078_RS07210 in Parabacteroides merdae CL09T00C40

Annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 336 to 355 (20 residues), see Phobius details PF05222: AlaDh_PNT_N" amino acids 28 to 160 (133 residues), 122.2 bits, see alignment E=1.9e-39 PF01262: AlaDh_PNT_C" amino acids 166 to 377 (212 residues), 164.1 bits, see alignment E=3.2e-52

Best Hits

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 84% identity to pdi:BDI_2808)

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>HMPREF1078_RS07210 alanine dehydrogenase (Parabacteroides merdae CL09T00C40)
MDRQGQGAYIPQELLKELSKASNRLLIGIPCERVEGERRLALTPEAVDMLTDRGHRVLVE
AGAGLGINYSDNHYSEAGAEIVATPAEVYQADIILKILPPLTAEVMMMKPRTTLFSTVQF
NTFSHEAFELMMAKRITAVAYELLADDKQRCPVLNVISEIEGTASITIASELLSNTQGGK
GILLGGIPGVSPTEVVIIGAGNAGTVATRAAMALGASVKVFDDDINKLRTIQQVLGQGLF
TSTFHPNVLQNAFRSADVVIGAMRYINTRHRYIIAEDMIRIMKRGALVIDLRINQGGCFE
TTCCLCPSDPAVFEQYGVLHYCRQNISNRVARTTSMALSNIFVPMLFLLGDAGAVQGMIK
SDPGFKNGVYMYCGKPVNSYVSNRFGLSSNNIDLYLSAF