Protein Info for HMPREF1078_RS06930 in Parabacteroides merdae CL09T00C40

Annotation: DUF5668 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 99 to 115 (17 residues), see Phobius details PF18917: LiaI-LiaF-like_TM1" amino acids 24 to 65 (42 residues), 36.4 bits, see alignment 4.4e-13 amino acids 72 to 114 (43 residues), 35.5 bits, see alignment 8.5e-13 PF22570: LiaF-TM" amino acids 25 to 120 (96 residues), 71.6 bits, see alignment E=7.9e-24

Best Hits

KEGG orthology group: None (inferred from 46% identity to bfr:BF0979)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>HMPREF1078_RS06930 DUF5668 domain-containing protein (Parabacteroides merdae CL09T00C40)
MRTNQQGNFIRGGYPSHSRLNTVTTAAVFIIVGLLFLGRNFGIIDSDLFGILVSWQMLLI
VVGVVNLIKRHFFGGVITIAIGAYFLLPEISWVEGEWLDMFWPVLFIFVGIMILFKPERH
HFNAHWDGRRPEYTKEVYGSEDGFIVSDNTFGSVQQIVLDPVFRGARLRNAFGGTVLDLR
RSKLEAPQTFIDIDCTFGGVEIYLPSDWNLLTQIDAFIGGCDDKRYNSSVEIDKEHILIV
RGKVSFGGIEFKS