Protein Info for HMPREF1078_RS04795 in Parabacteroides merdae CL09T00C40

Annotation: CDP-alcohol phosphatidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 199 to 227 (29 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 7 to 162 (156 residues), 66.5 bits, see alignment E=1.9e-22

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 68% identity to pdi:BDI_2569)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>HMPREF1078_RS04795 CDP-alcohol phosphatidyltransferase family protein (Parabacteroides merdae CL09T00C40)
MSIKNSIPNFVTCCSLISGCIACIMALRGNLPMATLWIVIAAVFDFGDGFAARSLHAYSP
MGKELDSLSDMVSFGVAPGMIVYWLLEQACMTAPVLGEAAGYVPYMALVIPVFSGLRLAK
FNIDERQTTSFIGMPVPAHALFWASIGYAFHSAVPVDSIGFIAGTIVAAILFSSLLVSEV
PMFSLKVKSLAWKGNELRYILVAGAVVFVTLFGVLGIAGTVILYITLSFFNKRR