Protein Info for HMPREF1078_RS04600 in Parabacteroides merdae CL09T00C40

Annotation: carbon starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details amino acids 445 to 464 (20 residues), see Phobius details PF02554: CstA" amino acids 4 to 143 (140 residues), 124.6 bits, see alignment E=5.1e-40 amino acids 158 to 302 (145 residues), 64.6 bits, see alignment E=8e-22 amino acids 307 to 428 (122 residues), 38.1 bits, see alignment E=8.3e-14 PF01566: Nramp" amino acids 72 to 373 (302 residues), 35.4 bits, see alignment E=6.2e-13

Best Hits

KEGG orthology group: None (inferred from 84% identity to pdi:BDI_2481)

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>HMPREF1078_RS04600 carbon starvation protein A (Parabacteroides merdae CL09T00C40)
MITFVCCLIALIVGYFIYGKFIERIFGIDAKRQTPAYTHQDGVDYIPMPTWKVFMIQFLN
IAGLGPIFGAIMGAKFGTASFLWIVLGSIFAGSVHDYLSGMLSLRHNGESLPEIIGRYLG
VNFKQFMRGFTVILMVLVGSVFVAGPAGLLAKLTPEHLDTTFWIIVVFLYYILATLLPVD
KIIGKIYPLFAAALLFMAIGILVMLFVNHPPLPEITDGMPNTYPGHLPIFPIMFVSIACG
AISGFHATQSPLMARCIKNEKYGRPIFFGSMITEGIVALIWAAAATYFYHNNGMGENNAA
VVVDSITKEWLGTVGGILAVLGVIAAPITSGDTAFRSARLIVADFLHLEQRSVSKRLMIC
IPLFLVAIALLLYSQKDKDGFDMIWRYFAWSNQTLAVFTLWALTVYLVISKKPYIVTLIP
ALFMTAVCSTYIFVAPEGLGMENGISQIIGFAITIVVLAFFLVWKKKTDNI