Protein Info for HMPREF1078_RS04515 in Parabacteroides merdae CL09T00C40

Annotation: DUF1080 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF06439: 3keto-disac_hyd" amino acids 67 to 281 (215 residues), 162.7 bits, see alignment E=5.2e-52

Best Hits

KEGG orthology group: None (inferred from 84% identity to pdi:BDI_2646)

MetaCyc: 70% identical to 3'-ketodisaccharide hydrolase (Bacteroides thetaiotaomicron)
RXN-22812 [EC: 3.2.1.218]

Predicted SEED Role

"Probable secreted glycosyl hydrolase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.218

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>HMPREF1078_RS04515 DUF1080 domain-containing protein (Parabacteroides merdae CL09T00C40)
MKKSVLLASAAIMMCYFTSCSGGKKTEEAAAPAEEAKTEAAVPEYKLMNDLPTVDLSTFP
KDADGKVTLFDGKSFNGWRGYGRTDVPAAWEVVDGTIHIKGSGAGEAGAKDGGDLVFAHK
FKNYEFEFEWKVGKGSNSGVLYMIQEVEGQPSYISAPEYQVLDNANHPDAKLGKDGNRQS
ASLYDMIPAKPQNSKPFGEWNKGKIMCYKGTVVHYQNDEPVVEYHLWTQQWKEMLDNSKF
SKDKWPLAYELLLNCGGENKEGFIGFQDHGDDVWYRNITIKELD